[INFO] fetching crate jean_io 0.1.0...
[INFO] testing jean_io-0.1.0 against master#1f7f8ea0721a3b1eb73e6c6d25cccb371434b320 for pr-154065-1
[INFO] extracting crate jean_io 0.1.0 into /workspace/builds/worker-0-tc1/source
[INFO] started tweaking crates.io crate jean_io 0.1.0
[INFO] finished tweaking crates.io crate jean_io 0.1.0
[INFO] tweaked toml for crates.io crate jean_io 0.1.0 written to /workspace/builds/worker-0-tc1/source/Cargo.toml
[INFO] validating manifest of crates.io crate jean_io 0.1.0 on toolchain 1f7f8ea0721a3b1eb73e6c6d25cccb371434b320
[INFO] running `Command { std: CARGO_HOME="/workspace/cargo-home" RUSTUP_HOME="/workspace/rustup-home" "/workspace/cargo-home/bin/cargo" "+1f7f8ea0721a3b1eb73e6c6d25cccb371434b320" "metadata" "--manifest-path" "Cargo.toml" "--no-deps", kill_on_drop: false }`
[INFO] running `Command { std: CARGO_HOME="/workspace/cargo-home" RUSTUP_HOME="/workspace/rustup-home" "/workspace/cargo-home/bin/cargo" "+1f7f8ea0721a3b1eb73e6c6d25cccb371434b320" "generate-lockfile" "--manifest-path" "Cargo.toml", kill_on_drop: false }`
[INFO] [stderr]     Updating crates.io index
[INFO] [stderr]      Locking 45 packages to latest compatible versions
[INFO] [stderr]       Adding generic-array v0.14.7 (available: v0.14.9)
[INFO] running `Command { std: CARGO_HOME="/workspace/cargo-home" RUSTUP_HOME="/workspace/rustup-home" "/workspace/cargo-home/bin/cargo" "+1f7f8ea0721a3b1eb73e6c6d25cccb371434b320" "fetch" "--manifest-path" "Cargo.toml", kill_on_drop: false }`
[INFO] [stderr]  Downloading crates ...
[INFO] [stderr]   Downloaded strum v0.24.1
[INFO] [stderr]   Downloaded jean_core v0.1.0
[INFO] running `Command { std: "docker" "create" "-v" "/var/lib/crater-agent-workspace/builds/worker-0-tc1/target:/opt/rustwide/target:rw,Z" "-v" "/var/lib/crater-agent-workspace/builds/worker-0-tc1/source:/opt/rustwide/workdir:ro,Z" "-v" "/var/lib/crater-agent-workspace/cargo-home:/opt/rustwide/cargo-home:ro,Z" "-v" "/var/lib/crater-agent-workspace/rustup-home:/opt/rustwide/rustup-home:ro,Z" "-e" "SOURCE_DIR=/opt/rustwide/workdir" "-e" "CARGO_TARGET_DIR=/opt/rustwide/target" "-e" "CARGO_HOME=/opt/rustwide/cargo-home" "-e" "RUSTUP_HOME=/opt/rustwide/rustup-home" "-w" "/opt/rustwide/workdir" "-m" "1610612736" "--user" "0:0" "--network" "none" "ghcr.io/rust-lang/crates-build-env/linux@sha256:d429b63d4308055ea97f60fb1d3dfca48854a00942f1bd2ad806beaf015945ec" "/opt/rustwide/cargo-home/bin/cargo" "+1f7f8ea0721a3b1eb73e6c6d25cccb371434b320" "metadata" "--no-deps" "--format-version=1", kill_on_drop: false }`
[INFO] [stdout] 3302282257d4d238c8237396c9eaff6750d26a124b4273743776a632ff302f52
[INFO] running `Command { std: "docker" "start" "-a" "3302282257d4d238c8237396c9eaff6750d26a124b4273743776a632ff302f52", kill_on_drop: false }`
[INFO] running `Command { std: "docker" "inspect" "3302282257d4d238c8237396c9eaff6750d26a124b4273743776a632ff302f52", kill_on_drop: false }`
[INFO] running `Command { std: "docker" "rm" "-f" "3302282257d4d238c8237396c9eaff6750d26a124b4273743776a632ff302f52", kill_on_drop: false }`
[INFO] [stdout] 3302282257d4d238c8237396c9eaff6750d26a124b4273743776a632ff302f52
[INFO] running `Command { std: "docker" "create" "-v" "/var/lib/crater-agent-workspace/builds/worker-0-tc1/target:/opt/rustwide/target:rw,Z" "-v" "/var/lib/crater-agent-workspace/builds/worker-0-tc1/source:/opt/rustwide/workdir:ro,Z" "-v" "/var/lib/crater-agent-workspace/cargo-home:/opt/rustwide/cargo-home:ro,Z" "-v" "/var/lib/crater-agent-workspace/rustup-home:/opt/rustwide/rustup-home:ro,Z" "-e" "SOURCE_DIR=/opt/rustwide/workdir" "-e" "CARGO_TARGET_DIR=/opt/rustwide/target" "-e" "CARGO_INCREMENTAL=0" "-e" "RUST_BACKTRACE=full" "-e" "RUSTFLAGS=--cap-lints=forbid" "-e" "RUSTDOCFLAGS=--cap-lints=forbid" "-e" "CARGO_HOME=/opt/rustwide/cargo-home" "-e" "RUSTUP_HOME=/opt/rustwide/rustup-home" "-w" "/opt/rustwide/workdir" "-m" "1610612736" "--user" "0:0" "--network" "none" "ghcr.io/rust-lang/crates-build-env/linux@sha256:d429b63d4308055ea97f60fb1d3dfca48854a00942f1bd2ad806beaf015945ec" "/opt/rustwide/cargo-home/bin/cargo" "+1f7f8ea0721a3b1eb73e6c6d25cccb371434b320" "build" "--frozen" "--message-format=json", kill_on_drop: false }`
[INFO] [stdout] 40f1461fa53b3e30ac306d2217ac6645c9ddac582c78de5de8fab1226f49fdb7
[INFO] running `Command { std: "docker" "start" "-a" "40f1461fa53b3e30ac306d2217ac6645c9ddac582c78de5de8fab1226f49fdb7", kill_on_drop: false }`
[INFO] [stderr]    Compiling hashbrown v0.16.1
[INFO] [stderr]    Compiling equivalent v1.0.2
[INFO] [stderr]    Compiling winnow v0.5.40
[INFO] [stderr]    Compiling toml_datetime v0.6.11
[INFO] [stderr]    Compiling ucd-trie v0.1.7
[INFO] [stderr]    Compiling once_cell v1.21.4
[INFO] [stderr]    Compiling regex-syntax v0.6.29
[INFO] [stderr]    Compiling beef v0.5.2
[INFO] [stderr]    Compiling fnv v1.0.7
[INFO] [stderr]    Compiling heck v0.4.1
[INFO] [stderr]    Compiling strum v0.24.1
[INFO] [stderr]    Compiling syn v1.0.109
[INFO] [stderr]    Compiling pest v2.8.6
[INFO] [stderr]    Compiling indexmap v2.13.0
[INFO] [stderr]    Compiling pest_meta v2.8.6
[INFO] [stderr]    Compiling toml_edit v0.19.15
[INFO] [stderr]    Compiling pest_generator v2.8.6
[INFO] [stderr]    Compiling pest_derive v2.8.6
[INFO] [stderr]    Compiling logos-derive v0.12.1
[INFO] [stderr]    Compiling strum_macros v0.24.3
[INFO] [stderr]    Compiling proc-macro-crate v1.3.1
[INFO] [stderr]    Compiling num_enum_derive v0.5.11
[INFO] [stderr]    Compiling num_enum v0.5.11
[INFO] [stderr]    Compiling logos v0.12.1
[INFO] [stderr]    Compiling jean_core v0.1.0
[INFO] [stderr]    Compiling jean_io v0.1.0 (/opt/rustwide/workdir)
[INFO] [stdout] warning: hiding a lifetime that's elided elsewhere is confusing
[INFO] [stdout]   --> src/formats/fasta/mod.rs:77:15
[INFO] [stdout]    |
[INFO] [stdout] 77 |   pub fn iter(&self) -> Iter<String, Entry> {
[INFO] [stdout]    |               ^^^^^     ^^^^^^^^^^^^^^^^^^^ the same lifetime is hidden here
[INFO] [stdout]    |               |
[INFO] [stdout]    |               the lifetime is elided here
[INFO] [stdout]    |
[INFO] [stdout]    = help: the same lifetime is referred to in inconsistent ways, making the signature confusing
[INFO] [stdout]    = note: `#[warn(mismatched_lifetime_syntaxes)]` on by default
[INFO] [stdout] help: use `'_` for type paths
[INFO] [stdout]    |
[INFO] [stdout] 77 |   pub fn iter(&self) -> Iter<'_, String, Entry> {
[INFO] [stdout]    |                              +++
[INFO] [stdout] 
[INFO] [stdout] 
[INFO] [stdout] warning: hiding a lifetime that's elided elsewhere is confusing
[INFO] [stdout]   --> src/formats/fasta/mod.rs:81:19
[INFO] [stdout]    |
[INFO] [stdout] 81 |   pub fn iter_mut(&mut self) -> IterMut<String, Entry> {
[INFO] [stdout]    |                   ^^^^^^^^^     ^^^^^^^^^^^^^^^^^^^^^^ the same lifetime is hidden here
[INFO] [stdout]    |                   |
[INFO] [stdout]    |                   the lifetime is elided here
[INFO] [stdout]    |
[INFO] [stdout]    = help: the same lifetime is referred to in inconsistent ways, making the signature confusing
[INFO] [stdout] help: use `'_` for type paths
[INFO] [stdout]    |
[INFO] [stdout] 81 |   pub fn iter_mut(&mut self) -> IterMut<'_, String, Entry> {
[INFO] [stdout]    |                                         +++
[INFO] [stdout] 
[INFO] [stdout] 
[INFO] [stdout] warning: hiding a lifetime that's elided elsewhere is confusing
[INFO] [stdout]   --> src/formats/gff3/mod.rs:86:15
[INFO] [stdout]    |
[INFO] [stdout] 86 |   pub fn iter(&self) -> Iter<String, Vec<Entry>> {
[INFO] [stdout]    |               ^^^^^     ^^^^^^^^^^^^^^^^^^^^^^^^ the same lifetime is hidden here
[INFO] [stdout]    |               |
[INFO] [stdout]    |               the lifetime is elided here
[INFO] [stdout]    |
[INFO] [stdout]    = help: the same lifetime is referred to in inconsistent ways, making the signature confusing
[INFO] [stdout] help: use `'_` for type paths
[INFO] [stdout]    |
[INFO] [stdout] 86 |   pub fn iter(&self) -> Iter<'_, String, Vec<Entry>> {
[INFO] [stdout]    |                              +++
[INFO] [stdout] 
[INFO] [stdout] 
[INFO] [stdout] warning: hiding a lifetime that's elided elsewhere is confusing
[INFO] [stdout]   --> src/formats/gff3/mod.rs:90:19
[INFO] [stdout]    |
[INFO] [stdout] 90 |   pub fn iter_mut(&mut self) -> IterMut<String, Vec<Entry>> {
[INFO] [stdout]    |                   ^^^^^^^^^     ^^^^^^^^^^^^^^^^^^^^^^^^^^^ the same lifetime is hidden here
[INFO] [stdout]    |                   |
[INFO] [stdout]    |                   the lifetime is elided here
[INFO] [stdout]    |
[INFO] [stdout]    = help: the same lifetime is referred to in inconsistent ways, making the signature confusing
[INFO] [stdout] help: use `'_` for type paths
[INFO] [stdout]    |
[INFO] [stdout] 90 |   pub fn iter_mut(&mut self) -> IterMut<'_, String, Vec<Entry>> {
[INFO] [stdout]    |                                         +++
[INFO] [stdout] 
[INFO] [stdout] 
[INFO] [stderr]     Finished `dev` profile [unoptimized + debuginfo] target(s) in 13.65s
[INFO] running `Command { std: "docker" "inspect" "40f1461fa53b3e30ac306d2217ac6645c9ddac582c78de5de8fab1226f49fdb7", kill_on_drop: false }`
[INFO] running `Command { std: "docker" "rm" "-f" "40f1461fa53b3e30ac306d2217ac6645c9ddac582c78de5de8fab1226f49fdb7", kill_on_drop: false }`
[INFO] [stdout] 40f1461fa53b3e30ac306d2217ac6645c9ddac582c78de5de8fab1226f49fdb7
[INFO] running `Command { std: "docker" "create" "-v" "/var/lib/crater-agent-workspace/builds/worker-0-tc1/target:/opt/rustwide/target:rw,Z" "-v" "/var/lib/crater-agent-workspace/builds/worker-0-tc1/source:/opt/rustwide/workdir:ro,Z" "-v" "/var/lib/crater-agent-workspace/cargo-home:/opt/rustwide/cargo-home:ro,Z" "-v" "/var/lib/crater-agent-workspace/rustup-home:/opt/rustwide/rustup-home:ro,Z" "-e" "SOURCE_DIR=/opt/rustwide/workdir" "-e" "CARGO_TARGET_DIR=/opt/rustwide/target" "-e" "CARGO_INCREMENTAL=0" "-e" "RUST_BACKTRACE=full" "-e" "RUSTFLAGS=--cap-lints=forbid" "-e" "RUSTDOCFLAGS=--cap-lints=forbid" "-e" "CARGO_HOME=/opt/rustwide/cargo-home" "-e" "RUSTUP_HOME=/opt/rustwide/rustup-home" "-w" "/opt/rustwide/workdir" "-m" "1610612736" "--user" "0:0" "--network" "none" "ghcr.io/rust-lang/crates-build-env/linux@sha256:d429b63d4308055ea97f60fb1d3dfca48854a00942f1bd2ad806beaf015945ec" "/opt/rustwide/cargo-home/bin/cargo" "+1f7f8ea0721a3b1eb73e6c6d25cccb371434b320" "test" "--frozen" "--no-run" "--message-format=json", kill_on_drop: false }`
[INFO] [stdout] 709699369a419a9a7b1ad4c4b059acbdb45753e5895251cb8f10f492de88e56f
[INFO] running `Command { std: "docker" "start" "-a" "709699369a419a9a7b1ad4c4b059acbdb45753e5895251cb8f10f492de88e56f", kill_on_drop: false }`
[INFO] [stdout] warning: hiding a lifetime that's elided elsewhere is confusing
[INFO] [stdout]   --> src/formats/fasta/mod.rs:77:15
[INFO] [stdout]    |
[INFO] [stdout] 77 |   pub fn iter(&self) -> Iter<String, Entry> {
[INFO] [stdout]    |               ^^^^^     ^^^^^^^^^^^^^^^^^^^ the same lifetime is hidden here
[INFO] [stdout]    |               |
[INFO] [stdout]    |               the lifetime is elided here
[INFO] [stdout]    |
[INFO] [stdout]    = help: the same lifetime is referred to in inconsistent ways, making the signature confusing
[INFO] [stdout]    = note: `#[warn(mismatched_lifetime_syntaxes)]` on by default
[INFO] [stdout] help: use `'_` for type paths
[INFO] [stdout]    |
[INFO] [stdout] 77 |   pub fn iter(&self) -> Iter<'_, String, Entry> {
[INFO] [stdout]    |                              +++
[INFO] [stdout] 
[INFO] [stdout] 
[INFO] [stdout] warning: hiding a lifetime that's elided elsewhere is confusing
[INFO] [stdout]   --> src/formats/fasta/mod.rs:81:19
[INFO] [stdout]    |
[INFO] [stdout] 81 |   pub fn iter_mut(&mut self) -> IterMut<String, Entry> {
[INFO] [stdout]    |                   ^^^^^^^^^     ^^^^^^^^^^^^^^^^^^^^^^ the same lifetime is hidden here
[INFO] [stdout]    |                   |
[INFO] [stdout]    |                   the lifetime is elided here
[INFO] [stdout]    |
[INFO] [stdout]    = help: the same lifetime is referred to in inconsistent ways, making the signature confusing
[INFO] [stdout] help: use `'_` for type paths
[INFO] [stdout]    |
[INFO] [stdout] 81 |   pub fn iter_mut(&mut self) -> IterMut<'_, String, Entry> {
[INFO] [stdout]    |                                         +++
[INFO] [stdout] 
[INFO] [stdout] 
[INFO] [stdout] warning: hiding a lifetime that's elided elsewhere is confusing
[INFO] [stdout]   --> src/formats/gff3/mod.rs:86:15
[INFO] [stdout]    |
[INFO] [stdout] 86 |   pub fn iter(&self) -> Iter<String, Vec<Entry>> {
[INFO] [stdout]    |               ^^^^^     ^^^^^^^^^^^^^^^^^^^^^^^^ the same lifetime is hidden here
[INFO] [stdout]    |               |
[INFO] [stdout]    |               the lifetime is elided here
[INFO] [stdout]    |
[INFO] [stdout]    = help: the same lifetime is referred to in inconsistent ways, making the signature confusing
[INFO] [stdout] help: use `'_` for type paths
[INFO] [stdout]    |
[INFO] [stdout] 86 |   pub fn iter(&self) -> Iter<'_, String, Vec<Entry>> {
[INFO] [stdout]    |                              +++
[INFO] [stdout] 
[INFO] [stdout] 
[INFO] [stdout] warning: hiding a lifetime that's elided elsewhere is confusing
[INFO] [stdout]   --> src/formats/gff3/mod.rs:90:19
[INFO] [stdout]    |
[INFO] [stdout] 90 |   pub fn iter_mut(&mut self) -> IterMut<String, Vec<Entry>> {
[INFO] [stdout]    |                   ^^^^^^^^^     ^^^^^^^^^^^^^^^^^^^^^^^^^^^ the same lifetime is hidden here
[INFO] [stdout]    |                   |
[INFO] [stdout]    |                   the lifetime is elided here
[INFO] [stdout]    |
[INFO] [stdout]    = help: the same lifetime is referred to in inconsistent ways, making the signature confusing
[INFO] [stdout] help: use `'_` for type paths
[INFO] [stdout]    |
[INFO] [stdout] 90 |   pub fn iter_mut(&mut self) -> IterMut<'_, String, Vec<Entry>> {
[INFO] [stdout]    |                                         +++
[INFO] [stdout] 
[INFO] [stdout] 
[INFO] [stderr]    Compiling jean_io v0.1.0 (/opt/rustwide/workdir)
[INFO] [stdout] warning: hiding a lifetime that's elided elsewhere is confusing
[INFO] [stdout]   --> src/formats/fasta/mod.rs:77:15
[INFO] [stdout]    |
[INFO] [stdout] 77 |   pub fn iter(&self) -> Iter<String, Entry> {
[INFO] [stdout]    |               ^^^^^     ^^^^^^^^^^^^^^^^^^^ the same lifetime is hidden here
[INFO] [stdout]    |               |
[INFO] [stdout]    |               the lifetime is elided here
[INFO] [stdout]    |
[INFO] [stdout]    = help: the same lifetime is referred to in inconsistent ways, making the signature confusing
[INFO] [stdout]    = note: `#[warn(mismatched_lifetime_syntaxes)]` on by default
[INFO] [stdout] help: use `'_` for type paths
[INFO] [stdout]    |
[INFO] [stdout] 77 |   pub fn iter(&self) -> Iter<'_, String, Entry> {
[INFO] [stdout]    |                              +++
[INFO] [stdout] 
[INFO] [stdout] 
[INFO] [stdout] warning: hiding a lifetime that's elided elsewhere is confusing
[INFO] [stdout]   --> src/formats/fasta/mod.rs:81:19
[INFO] [stdout]    |
[INFO] [stdout] 81 |   pub fn iter_mut(&mut self) -> IterMut<String, Entry> {
[INFO] [stdout]    |                   ^^^^^^^^^     ^^^^^^^^^^^^^^^^^^^^^^ the same lifetime is hidden here
[INFO] [stdout]    |                   |
[INFO] [stdout]    |                   the lifetime is elided here
[INFO] [stdout]    |
[INFO] [stdout]    = help: the same lifetime is referred to in inconsistent ways, making the signature confusing
[INFO] [stdout] help: use `'_` for type paths
[INFO] [stdout]    |
[INFO] [stdout] 81 |   pub fn iter_mut(&mut self) -> IterMut<'_, String, Entry> {
[INFO] [stdout]    |                                         +++
[INFO] [stdout] 
[INFO] [stdout] 
[INFO] [stdout] warning: hiding a lifetime that's elided elsewhere is confusing
[INFO] [stdout]   --> src/formats/gff3/mod.rs:86:15
[INFO] [stdout]    |
[INFO] [stdout] 86 |   pub fn iter(&self) -> Iter<String, Vec<Entry>> {
[INFO] [stdout]    |               ^^^^^     ^^^^^^^^^^^^^^^^^^^^^^^^ the same lifetime is hidden here
[INFO] [stdout]    |               |
[INFO] [stdout]    |               the lifetime is elided here
[INFO] [stdout]    |
[INFO] [stdout]    = help: the same lifetime is referred to in inconsistent ways, making the signature confusing
[INFO] [stdout] help: use `'_` for type paths
[INFO] [stdout]    |
[INFO] [stdout] 86 |   pub fn iter(&self) -> Iter<'_, String, Vec<Entry>> {
[INFO] [stdout]    |                              +++
[INFO] [stdout] 
[INFO] [stdout] 
[INFO] [stdout] warning: hiding a lifetime that's elided elsewhere is confusing
[INFO] [stdout]   --> src/formats/gff3/mod.rs:90:19
[INFO] [stdout]    |
[INFO] [stdout] 90 |   pub fn iter_mut(&mut self) -> IterMut<String, Vec<Entry>> {
[INFO] [stdout]    |                   ^^^^^^^^^     ^^^^^^^^^^^^^^^^^^^^^^^^^^^ the same lifetime is hidden here
[INFO] [stdout]    |                   |
[INFO] [stdout]    |                   the lifetime is elided here
[INFO] [stdout]    |
[INFO] [stdout]    = help: the same lifetime is referred to in inconsistent ways, making the signature confusing
[INFO] [stdout] help: use `'_` for type paths
[INFO] [stdout]    |
[INFO] [stdout] 90 |   pub fn iter_mut(&mut self) -> IterMut<'_, String, Vec<Entry>> {
[INFO] [stdout]    |                                         +++
[INFO] [stdout] 
[INFO] [stdout] 
[INFO] [stderr]     Finished `test` profile [unoptimized + debuginfo] target(s) in 1.48s
[INFO] running `Command { std: "docker" "inspect" "709699369a419a9a7b1ad4c4b059acbdb45753e5895251cb8f10f492de88e56f", kill_on_drop: false }`
[INFO] running `Command { std: "docker" "rm" "-f" "709699369a419a9a7b1ad4c4b059acbdb45753e5895251cb8f10f492de88e56f", kill_on_drop: false }`
[INFO] [stdout] 709699369a419a9a7b1ad4c4b059acbdb45753e5895251cb8f10f492de88e56f
[INFO] running `Command { std: "docker" "create" "-v" "/var/lib/crater-agent-workspace/builds/worker-0-tc1/target:/opt/rustwide/target:rw,Z" "-v" "/var/lib/crater-agent-workspace/builds/worker-0-tc1/source:/opt/rustwide/workdir:ro,Z" "-v" "/var/lib/crater-agent-workspace/cargo-home:/opt/rustwide/cargo-home:ro,Z" "-v" "/var/lib/crater-agent-workspace/rustup-home:/opt/rustwide/rustup-home:ro,Z" "-e" "SOURCE_DIR=/opt/rustwide/workdir" "-e" "CARGO_TARGET_DIR=/opt/rustwide/target" "-e" "CARGO_INCREMENTAL=0" "-e" "RUST_BACKTRACE=full" "-e" "RUSTFLAGS=--cap-lints=forbid" "-e" "RUSTDOCFLAGS=--cap-lints=forbid" "-e" "CARGO_HOME=/opt/rustwide/cargo-home" "-e" "RUSTUP_HOME=/opt/rustwide/rustup-home" "-w" "/opt/rustwide/workdir" "-m" "1610612736" "--user" "0:0" "--network" "none" "ghcr.io/rust-lang/crates-build-env/linux@sha256:d429b63d4308055ea97f60fb1d3dfca48854a00942f1bd2ad806beaf015945ec" "/opt/rustwide/cargo-home/bin/cargo" "+1f7f8ea0721a3b1eb73e6c6d25cccb371434b320" "test" "--frozen", kill_on_drop: false }`
[INFO] [stdout] a731e1215b6e96a08349e690165eaca1e2ee1cbd45fc309ab5686338e597748a
[INFO] running `Command { std: "docker" "start" "-a" "a731e1215b6e96a08349e690165eaca1e2ee1cbd45fc309ab5686338e597748a", kill_on_drop: false }`
[INFO] [stderr] warning: hiding a lifetime that's elided elsewhere is confusing
[INFO] [stderr]   --> src/formats/fasta/mod.rs:77:15
[INFO] [stderr]    |
[INFO] [stderr] 77 |   pub fn iter(&self) -> Iter<String, Entry> {
[INFO] [stderr]    |               ^^^^^     ^^^^^^^^^^^^^^^^^^^ the same lifetime is hidden here
[INFO] [stderr]    |               |
[INFO] [stderr]    |               the lifetime is elided here
[INFO] [stderr]    |
[INFO] [stderr]    = help: the same lifetime is referred to in inconsistent ways, making the signature confusing
[INFO] [stderr]    = note: `#[warn(mismatched_lifetime_syntaxes)]` on by default
[INFO] [stderr] help: use `'_` for type paths
[INFO] [stderr]    |
[INFO] [stderr] 77 |   pub fn iter(&self) -> Iter<'_, String, Entry> {
[INFO] [stderr]    |                              +++
[INFO] [stderr] 
[INFO] [stderr] warning: hiding a lifetime that's elided elsewhere is confusing
[INFO] [stderr]   --> src/formats/fasta/mod.rs:81:19
[INFO] [stderr]    |
[INFO] [stderr] 81 |   pub fn iter_mut(&mut self) -> IterMut<String, Entry> {
[INFO] [stderr]    |                   ^^^^^^^^^     ^^^^^^^^^^^^^^^^^^^^^^ the same lifetime is hidden here
[INFO] [stderr]    |                   |
[INFO] [stderr]    |                   the lifetime is elided here
[INFO] [stderr]    |
[INFO] [stderr]    = help: the same lifetime is referred to in inconsistent ways, making the signature confusing
[INFO] [stderr] help: use `'_` for type paths
[INFO] [stderr]    |
[INFO] [stderr] 81 |   pub fn iter_mut(&mut self) -> IterMut<'_, String, Entry> {
[INFO] [stderr]    |                                         +++
[INFO] [stderr] 
[INFO] [stderr] warning: hiding a lifetime that's elided elsewhere is confusing
[INFO] [stderr]   --> src/formats/gff3/mod.rs:86:15
[INFO] [stderr]    |
[INFO] [stderr] 86 |   pub fn iter(&self) -> Iter<String, Vec<Entry>> {
[INFO] [stderr]    |               ^^^^^     ^^^^^^^^^^^^^^^^^^^^^^^^ the same lifetime is hidden here
[INFO] [stderr]    |               |
[INFO] [stderr]    |               the lifetime is elided here
[INFO] [stderr]    |
[INFO] [stderr]    = help: the same lifetime is referred to in inconsistent ways, making the signature confusing
[INFO] [stderr] help: use `'_` for type paths
[INFO] [stderr]    |
[INFO] [stderr] 86 |   pub fn iter(&self) -> Iter<'_, String, Vec<Entry>> {
[INFO] [stderr]    |                              +++
[INFO] [stderr] 
[INFO] [stderr] warning: hiding a lifetime that's elided elsewhere is confusing
[INFO] [stderr]   --> src/formats/gff3/mod.rs:90:19
[INFO] [stderr]    |
[INFO] [stderr] 90 |   pub fn iter_mut(&mut self) -> IterMut<String, Vec<Entry>> {
[INFO] [stderr]    |                   ^^^^^^^^^     ^^^^^^^^^^^^^^^^^^^^^^^^^^^ the same lifetime is hidden here
[INFO] [stderr]    |                   |
[INFO] [stderr]    |                   the lifetime is elided here
[INFO] [stderr]    |
[INFO] [stderr]    = help: the same lifetime is referred to in inconsistent ways, making the signature confusing
[INFO] [stderr] help: use `'_` for type paths
[INFO] [stderr]    |
[INFO] [stderr] 90 |   pub fn iter_mut(&mut self) -> IterMut<'_, String, Vec<Entry>> {
[INFO] [stderr]    |                                         +++
[INFO] [stderr] 
[INFO] [stderr] warning: `jean_io` (lib) generated 4 warnings (run `cargo fix --lib -p jean_io` to apply 4 suggestions)
[INFO] [stderr] warning: `jean_io` (lib test) generated 4 warnings (4 duplicates)
[INFO] [stderr]     Finished `test` profile [unoptimized + debuginfo] target(s) in 0.12s
[INFO] [stderr]      Running unittests src/lib.rs (/opt/rustwide/target/debug/deps/jean_io-6499453df787e46c)
[INFO] [stdout] 
[INFO] [stdout] running 4 tests
[INFO] [stdout] test formats::gff3::parser::tests::test_1 ... ok
[INFO] [stdout] test formats::fasta::parser::tests::test_1 ... ok
[INFO] [stdout] test formats::fasta::tests::test_read ... ok
[INFO] [stdout] >seq1 
[INFO] [stderr]      Running tests/mod.rs (/opt/rustwide/target/debug/deps/mod-028d4a8ecd1329d3)
[INFO] [stdout] MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDT
[INFO] [stdout] DSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK*
[INFO] [stdout] 
[INFO] [stdout] test formats::fasta::tests::test_write ... ok
[INFO] [stdout] 
[INFO] [stdout] test result: ok. 4 passed; 0 failed; 0 ignored; 0 measured; 0 filtered out; finished in 0.03s
[INFO] [stdout] 
[INFO] [stdout] 
[INFO] [stdout] running 2 tests
[INFO] [stdout] test fasta::test_read ... ok
[INFO] [stderr]    Doc-tests jean_io
[INFO] [stdout] test gff3::test_read ... ok
[INFO] [stdout] 
[INFO] [stdout] test result: ok. 2 passed; 0 failed; 0 ignored; 0 measured; 0 filtered out; finished in 2.29s
[INFO] [stdout] 
[INFO] [stdout] 
[INFO] [stdout] running 0 tests
[INFO] [stdout] 
[INFO] [stdout] test result: ok. 0 passed; 0 failed; 0 ignored; 0 measured; 0 filtered out; finished in 0.00s
[INFO] [stdout] 
[INFO] running `Command { std: "docker" "inspect" "a731e1215b6e96a08349e690165eaca1e2ee1cbd45fc309ab5686338e597748a", kill_on_drop: false }`
[INFO] running `Command { std: "docker" "rm" "-f" "a731e1215b6e96a08349e690165eaca1e2ee1cbd45fc309ab5686338e597748a", kill_on_drop: false }`
[INFO] [stdout] a731e1215b6e96a08349e690165eaca1e2ee1cbd45fc309ab5686338e597748a
